Protein Info for Psyr_1778 in Pseudomonas syringae pv. syringae B728a

Annotation: PAS/PAC sensor hybrid histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 956 TIGR00229: PAS domain S-box protein" amino acids 27 to 144 (118 residues), 69.8 bits, see alignment E=1.2e-23 amino acids 152 to 280 (129 residues), 39 bits, see alignment E=4.1e-14 PF13188: PAS_8" amino acids 28 to 75 (48 residues), 29.5 bits, see alignment 2.3e-10 amino acids 285 to 348 (64 residues), 21.5 bits, see alignment 7.7e-08 PF00989: PAS" amino acids 33 to 141 (109 residues), 57.9 bits, see alignment E=4.4e-19 amino acids 156 to 269 (114 residues), 23.6 bits, see alignment E=2e-08 PF08448: PAS_4" amino acids 35 to 145 (111 residues), 39.4 bits, see alignment E=2.8e-13 PF13426: PAS_9" amino acids 41 to 142 (102 residues), 51.6 bits, see alignment E=4.6e-17 PF08447: PAS_3" amino acids 52 to 137 (86 residues), 32.6 bits, see alignment E=3.7e-11 amino acids 179 to 266 (88 residues), 73.1 bits, see alignment E=8.5e-24 amino acids 443 to 530 (88 residues), 56 bits, see alignment E=1.9e-18 PF00512: HisKA" amino acids 586 to 650 (65 residues), 32.7 bits, see alignment 2.7e-11 PF02518: HATPase_c" amino acids 694 to 813 (120 residues), 71.9 bits, see alignment E=2.7e-23 PF00072: Response_reg" amino acids 839 to 950 (112 residues), 55.6 bits, see alignment E=2.6e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1778)

Predicted SEED Role

"FOG: PAS/PAC domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVJ6 at UniProt or InterPro

Protein Sequence (956 amino acids)

>Psyr_1778 PAS/PAC sensor hybrid histidine kinase (Pseudomonas syringae pv. syringae B728a)
MDLRRMLEEAGIDAATNTCRPSAVARAARQRAVFDSAMDFAMILTDGNGIITDWNPGAEQ
VLGWTQEEMVGQSAKRFFTPEDLASNRVEHEMQLALSVGRASDERWHLRKDGELFWASGE
MMPLYDENNTHLGFVKILRDRTREHLAGRATEEAQERYRLAAKATNDSIWDWDFATNLVL
WNDALEEAYGHPLATLDNSGDWWIGQIHPDDRTRVYDSIHAVIDGNGTAWTDEYRFRRLD
GSYADVLDRGHVIRDIDGQAVRMIGAMLDMSQMRKAETALRQSEERSRAMLETIEAAFAI
IQVRFDADDSPVDYRFIEANPAFERQAGVDLRGKWVTEFAPDLERFWFEAYGNVAKTGEP
ASFENYAKAFERWFEVKAVRVGEPADRQIAVIFSDVTARRDAEERLRTSEAVARENIDRV
QLALAAGAIIGTWHWDLPTDRFTVDEAFAKAFGLDPALGREGLSLEQVIATVHPEDKQGL
ITAINAVITNGRVYAHQYRVRRTDGIYYWIEANGRVDRAEDGTPLSFPGVLINVDERRAV
AAERDRATAALRALNDTLEQRVAARTTELMQAEEKLRQSQKMEAVGQLTGGLAHDFNNLL
AGISGALELMGTRIEQGRWGEVDKYIVTAQGAAKRAAALTHRLLAFSRRQTLDPQPTDVN
RLMKGMTDLIQRTVGPSIVVETLGATGLWPTLVDASQLENALLNLCINARDAMPDGGRIT
IEASNRWIDGDVARAHDMPEGHYLSLCVTDTGTGMTPDVIAKAFDPFFTTKPIGQGTGLG
LSMIYGFANQSGGRVRIQSEVGKGTAISLYLPRYDGTAARDEGDVHKAPFEFTQSGETIL
IVDDEPTVRMLLTDALGDLGYTLIEAADSLAGLKLLRSDVHIDLLITDVGLPGGMNGRQM
ADAGREVRPHLKTLFITGYAENAAIGDEQLGPGMRVLTKPFAIEALAARVQELMGA