Protein Info for Psyr_1777 in Pseudomonas syringae pv. syringae B728a

Annotation: transcriptional regulator, TetR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 PF00440: TetR_N" amino acids 12 to 58 (47 residues), 59.7 bits, see alignment 1.9e-20 PF08362: TetR_C_3" amino acids 59 to 200 (142 residues), 204.7 bits, see alignment E=6.3e-65

Best Hits

Swiss-Prot: 38% identical to RUTR_ECOLI: HTH-type transcriptional regulator RutR (rutR) from Escherichia coli (strain K12)

KEGG orthology group: K09017, TetR/AcrR family transcriptional regulator (inferred from 100% identity to psb:Psyr_1777)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVJ7 at UniProt or InterPro

Protein Sequence (202 amino acids)

>Psyr_1777 transcriptional regulator, TetR family (Pseudomonas syringae pv. syringae B728a)
MSSIRERNKELILRAASEEFADKGFAASKTSDIAAKAGVPKPNVYYYFKSKENLYREVLE
SIIEPILRASTPFNPEGVPAEVLSRYIRSKIQISRDLPFASKVFASEIMHGAPHLTAQQI
EQLNGQARHNIECIQAWIDSGQIAPLDPHHLMFTIWAATQTYADFDWQIATVTGKAKLQD
ADYEAATRTILRLVLKGCEPDR