Protein Info for Psyr_1774 in Pseudomonas syringae pv. syringae B728a

Annotation: Mg2+ transporter protein, CorA-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 transmembrane" amino acids 294 to 317 (24 residues), see Phobius details amino acids 330 to 349 (20 residues), see Phobius details PF01544: CorA" amino acids 64 to 347 (284 residues), 165.6 bits, see alignment E=8.3e-53

Best Hits

KEGG orthology group: K03284, metal ion transporter, MIT family (inferred from 100% identity to psb:Psyr_1774)

Predicted SEED Role

"Magnesium and cobalt transport protein CorA" in subsystem Campylobacter Iron Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVK0 at UniProt or InterPro

Protein Sequence (355 amino acids)

>Psyr_1774 Mg2+ transporter protein, CorA-like protein (Pseudomonas syringae pv. syringae B728a)
MRPSPPLPGPGRAWTAMNHSIAHHHQDSDLFGLLYGFRFRHGESGQEIGSAAALDYLQNP
PEENGFIWLHLNLSHAACERWMKAQLDLPEEFFEALHEGSRSTRIEHVDTTLLAVVNDVV
FDFNRLSTDISTLWVCARQRLLITARLQPLRSVDKLRSAVKRGEQFDSPLELLAHLLSDQ
GEVLTQFLRKTSVNVDRIEDQLLSQRLSNNRSELGAMRRVLVRLQRLLALEPGSLMRLLH
KPPQWLREQDVQALRQSIEESSLVINDLTALGERIKLLQEEIAANLNEQSSRTLFTLTVV
TVLALPINIVAGFFGMNVGGVPLASDPEGFWILVALVATFTLVAGRWAFRKRGDY