Protein Info for Psyr_1771 in Pseudomonas syringae pv. syringae B728a

Annotation: Major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 559 transmembrane" amino acids 33 to 59 (27 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details amino acids 222 to 246 (25 residues), see Phobius details amino acids 252 to 272 (21 residues), see Phobius details amino acids 284 to 305 (22 residues), see Phobius details amino acids 326 to 346 (21 residues), see Phobius details amino acids 353 to 370 (18 residues), see Phobius details amino acids 386 to 410 (25 residues), see Phobius details amino acids 418 to 441 (24 residues), see Phobius details amino acids 509 to 530 (22 residues), see Phobius details PF07690: MFS_1" amino acids 41 to 434 (394 residues), 50.5 bits, see alignment E=7.5e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1771)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVK3 at UniProt or InterPro

Protein Sequence (559 amino acids)

>Psyr_1771 Major facilitator superfamily (Pseudomonas syringae pv. syringae B728a)
MSDKYAPREWAAHERPTMPGSPSTPLHSTARRWAFAVVGVIVALTGGLGNALVVANLPYL
QGALGATSQDIAWLPAAYIMTNVSMNLLLVKFRQQFGLRAFTELFLVLYALVTLAHLFVN
DIDSAIAVRAAHGMVGAALSTLGLYYMIQAFPQKWRLKALVLGIGTAQLATPLARLVSED
LLQIAQWRGLYLFELGMALLSLGCVLLLKLPPGDRFKAFEKLDFLTFGLLASGFALFCAV
LSLGRIEWWLEAQWLGIASAASIALICTGLAIEHNRSNPLLITRWLGSGAILRLGLAVIL
FRVVLSEQSVGAVGFLQALNMGSQQLHTLYLVMLLGSVSGLAVSALTINPAHLIKPLLIS
LAMMAVGAWMDSHSTNLTRQSNMYLSQFLLAFGGTFFLGPTLVLGISGVLANPRNMVSFS
VLFGITQNIGGLIGSAALGTFQVVREKFHSSYIVEHLTLIDPLVQARLQSYSASYSSVLA
DPSLRNSQGIRAMATAATREANVLAYNDVFMLIALIAVLTMIWISARVLWLKMTTQPLAL
APVAPAASPSVSNSGVKSS