Protein Info for Psyr_1769 in Pseudomonas syringae pv. syringae B728a

Annotation: Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, central region:Acyl-CoA dehydrogenase, N-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 PF02771: Acyl-CoA_dh_N" amino acids 7 to 118 (112 residues), 134.9 bits, see alignment E=3.3e-43 PF02770: Acyl-CoA_dh_M" amino acids 123 to 218 (96 residues), 89.3 bits, see alignment E=3e-29 PF00441: Acyl-CoA_dh_1" amino acids 230 to 378 (149 residues), 180 bits, see alignment E=6.5e-57 PF08028: Acyl-CoA_dh_2" amino acids 245 to 366 (122 residues), 102.5 bits, see alignment E=4.7e-33

Best Hits

Swiss-Prot: 51% identical to ACDB_BACSU: Acyl-CoA dehydrogenase (mmgC) from Bacillus subtilis (strain 168)

KEGG orthology group: K00257, [EC: 1.3.99.-] (inferred from 100% identity to psb:Psyr_1769)

MetaCyc: 57% identical to short-chain acyl-CoA dehydrogenase monomer (Pseudomonas putida KT2440)
RXN-13449 [EC: 1.3.8.1]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.1, 1.3.99.-

Use Curated BLAST to search for 1.3.8.1 or 1.3.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVK5 at UniProt or InterPro

Protein Sequence (383 amino acids)

>Psyr_1769 Acyl-CoA dehydrogenase, C-terminal:Acyl-CoA dehydrogenase, central region:Acyl-CoA dehydrogenase, N-terminal (Pseudomonas syringae pv. syringae B728a)
MHDLELSEEQVMIRDMARDFARNEIAPYAQAWEKAGWIDDALVAKLGELGLLGMVVPEQW
GGTYIDYVAYALAVEEISAADAATGTLMSVHSSVGCGPVLNYGTDEQKHAWLEKLATGRA
IGCFCLTEPHAGSEAHNLRTRAELQGDEWVINGAKQFVSNGKRAQLAIVFAVTDPALGKK
GLSAFLVPTENPGFVVDRSEHKMGIRASDTCAVTLNNCRIPAANLLGERGKGLSIALSNL
EGGRIGIAAQALGIARAAFEAALAYARERVQFDKPIIEHQSIANLLADMHTRINAARLLT
LHAARLRSAGQACLSEASQAKLFASEMAEWVCSKAIQIHGGYGYLEDYPVERYYRDARIT
QIYEGSSEIQRLLIARELRHYLV