Protein Info for Psyr_1757 in Pseudomonas syringae pv. syringae B728a

Annotation: Binding-protein-dependent transport systems inner membrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 transmembrane" amino acids 9 to 30 (22 residues), see Phobius details amino acids 128 to 147 (20 residues), see Phobius details amino acids 163 to 190 (28 residues), see Phobius details amino acids 215 to 237 (23 residues), see Phobius details amino acids 273 to 300 (28 residues), see Phobius details amino acids 320 to 345 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 143 to 350 (208 residues), 123.9 bits, see alignment E=3.3e-40

Best Hits

Swiss-Prot: 63% identical to YEJB_ECO57: Inner membrane ABC transporter permease protein YejB (yejB) from Escherichia coli O157:H7

KEGG orthology group: K13894, microcin C transport system permease protein (inferred from 100% identity to psp:PSPPH_1706)

MetaCyc: 63% identical to putative oligopeptide ABC transporter membrane subunit YejB (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVL7 at UniProt or InterPro

Protein Sequence (357 amino acids)

>Psyr_1757 Binding-protein-dependent transport systems inner membrane component (Pseudomonas syringae pv. syringae B728a)
MLAYILRRLLLIIPTLLGILIINFVIIQAAPGGPVEQMIAKIEGFDGATSRIAGGGAEVS
VAGSNYRGAQGLDPALIKEIERMYGFDKSAPERLWIMIKNYATLDFGDSFFRDAKVIDLI
VEKMPVSISLGLWSTLIMYLVSIPLGIAKATRHGSQFDVWTSSAIIVGYAIPAFLFAILL
IVVFAGGSYFNWFPLRGLTSNNYDELSTLGKVFDYFWHLVLPVTALVIGNFATMTLLTKN
SFLDEISKQYVTTAKAKGLSNHKVLYGHVFRNAMLLVIAGFPSAFIGIFFTGSLLVEVIF
SLDGLGLMSFEAAINRDYPVVFGTLFIFTLLGLVVKLIGDITYTLVDPRIDFESRKH