Protein Info for Psyr_1748 in Pseudomonas syringae pv. syringae B728a

Annotation: ATP-dependent Clp protease ATP-binding subunit ClpX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 TIGR00382: ATP-dependent Clp protease, ATP-binding subunit ClpX" amino acids 10 to 413 (404 residues), 692.1 bits, see alignment E=1.3e-212 PF06689: zf-C4_ClpX" amino acids 15 to 51 (37 residues), 71.2 bits, see alignment 2.1e-23 PF00493: MCM" amino acids 70 to 195 (126 residues), 24.1 bits, see alignment E=7.3e-09 PF01078: Mg_chelatase" amino acids 113 to 139 (27 residues), 21.1 bits, see alignment (E = 7.5e-08) PF07724: AAA_2" amino acids 114 to 311 (198 residues), 121.6 bits, see alignment E=1.5e-38 PF07728: AAA_5" amino acids 116 to 193 (78 residues), 26.3 bits, see alignment E=2.7e-09 PF00004: AAA" amino acids 117 to 223 (107 residues), 57.3 bits, see alignment E=9.5e-19 PF10431: ClpB_D2-small" amino acids 318 to 395 (78 residues), 42.1 bits, see alignment E=2.9e-14

Best Hits

Swiss-Prot: 100% identical to CLPX_PSEU2: ATP-dependent Clp protease ATP-binding subunit ClpX (clpX) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K03544, ATP-dependent Clp protease ATP-binding subunit ClpX (inferred from 100% identity to pst:PSPTO_3725)

MetaCyc: 78% identical to ATP-dependent Clp protease ATP-binding subunit ClpX (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpX" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVM6 at UniProt or InterPro

Protein Sequence (427 amino acids)

>Psyr_1748 ATP-dependent Clp protease ATP-binding subunit ClpX (Pseudomonas syringae pv. syringae B728a)
MTDTRNGEDNGKLLYCSFCGKSQHEVRKLIAGPSVFICDECVDLCNDIIREEVQEAQAES
SAHKLPSPKEISGILDQYVIGQERAKKVLAVAVYNHYKRLNQRDKKNDDVELGKSNILLI
GPTGSGKTLLAETLARLLNVPFTIADATTLTEAGYVGEDVENIIQKLLQKCDYDVEKAQM
GIVYIDEIDKISRKSDNPSITRDVSGEGVQQALLKLIEGTVASVPPQGGRKHPQQEFLQV
DTRNILFICGGAFSGLEKVIQNRSTRGGIGFNAEVRSKEEGKKVGESLREVEPDDLVKFG
LIPEFVGRLPVLATLDELDEAALIQILTEPKNALTKQYAKLFEMEGVDLEFRTDALKSVA
RRALERKTGARGLRSILEGVLLDTMYEIPSQSDVSKVVIDESVIDGTSKPLLIYENSEPP
AKVAPDA