Protein Info for Psyr_1740 in Pseudomonas syringae pv. syringae B728a

Annotation: carbohydrate ABC transporter membrane protein 2, CUT1 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 131 to 151 (21 residues), see Phobius details amino acids 176 to 201 (26 residues), see Phobius details amino acids 232 to 253 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 83 to 256 (174 residues), 37.4 bits, see alignment E=1.1e-13

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 99% identity to psp:PSPPH_1684)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpE (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVN4 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Psyr_1740 carbohydrate ABC transporter membrane protein 2, CUT1 family (Pseudomonas syringae pv. syringae B728a)
MSLRKTIPLWIYLLFLLVPIYWLVNMSFKTNTEILGGLTLWPQDFTLANYKVIFTDESWY
SGYLNSLYYVCLNTVISLSVALPAAYAFSRYRFLGDKHLFFWLLTNRMAPPAVFLLPFFQ
LYSSIGLFDTHIAVALAHCLFNVPLAVWILEGFMSGVPKEIDETAYIDGYSFPKFFVKIF
IPLIGSGIGVTAFFCFMFSWVELLLARTLTSVNAKPIAAVMTRTVSASGIDWGVLAAAGV
LTILPGMLVIWFVRNHVVKGFALGRV