Protein Info for Psyr_1739 in Pseudomonas syringae pv. syringae B728a

Annotation: carbohydrate ABC transporter membrane protein 1, CUT1 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 transmembrane" amino acids 10 to 33 (24 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 100 to 123 (24 residues), see Phobius details amino acids 153 to 175 (23 residues), see Phobius details amino acids 208 to 226 (19 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 81 to 278 (198 residues), 62.4 bits, see alignment E=2.4e-21

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to pst:PSPTO_3738)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpA (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVN5 at UniProt or InterPro

Protein Sequence (288 amino acids)

>Psyr_1739 carbohydrate ABC transporter membrane protein 1, CUT1 family (Pseudomonas syringae pv. syringae B728a)
MRKVQNNKAWWLVMPVFLLVAFSAIIPMMTVVNYSVQDIFDQSSRYFVGTDWFRQVLQDP
RLHDSLLRQFIYSGCVLLIEIPLGIAIALTMPTKGRWSSLCLIVMTIPLLIPWNVVGTIW
QIFGRGDIGLLGYTLNNVLGINYNYAANASDAWVTVLVIDVWHWTSLVALLCYSGLRAIP
DVYYQAARIDRASGWAIFRHIQLPKMKSVLLIAVMLRFMDSFMIYTEPFVLTGGGPGNST
TFLSQTLTTMALGQFDLGPAAAFSLVYFLIILLVSWVFYTAMTHSEKN