Protein Info for Psyr_1718 in Pseudomonas syringae pv. syringae B728a

Annotation: von Willebrand factor, type A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details amino acids 24 to 25 (2 residues), see Phobius details transmembrane" amino acids 22 to 23 (2 residues), see Phobius details amino acids 60 to 75 (16 residues), see Phobius details amino acids 303 to 323 (21 residues), see Phobius details PF00092: VWA" amino acids 91 to 281 (191 residues), 74.2 bits, see alignment E=2.5e-24 PF13519: VWA_2" amino acids 93 to 203 (111 residues), 54.5 bits, see alignment E=2.5e-18

Best Hits

KEGG orthology group: K07114, uncharacterized protein (inferred from 100% identity to psb:Psyr_1718)

Predicted SEED Role

"BatA (Bacteroides aerotolerance operon)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVQ6 at UniProt or InterPro

Protein Sequence (352 amino acids)

>Psyr_1718 von Willebrand factor, type A (Pseudomonas syringae pv. syringae B728a)
MFEFAWPWAFVLLPLPWLMRALLPMADSGEPALKVSFLSELEGLSGRRAKANLPVWRQRA
PFLLIWLLLLITTARPQWLGEPLPVAASGRDLLVAVDVSGSMDYPDMQWKSDEVSRLVLV
QQLLGDFLEGRKGDRVGLILFGTQAFVQAPLTYDRRTVRVWLDEARIGIAGKNTALGDAI
GLALKRLRMRPATSRALVLVTDGANNAGQIDPVTAARLAAEEGVKIYAIGIGSDPDKDAL
QSVLGLNPSLDLDEPTLKEIASLSGGQYFRARDGDQLEKIRATLDALEPVAQQPTQARPA
QALYQWPLATALLLSVLLVLRELWPNNALQRLLAVVRSINWRERCKSLWRSR