Protein Info for Psyr_1696 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function DUF350

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 141 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 55 to 77 (23 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 116 to 135 (20 residues), see Phobius details PF03994: DUF350" amino acids 12 to 137 (126 residues), 119.6 bits, see alignment E=5.2e-39

Best Hits

Swiss-Prot: 39% identical to YJFL_ECOLI: UPF0719 inner membrane protein YjfL (yjfL) from Escherichia coli (strain K12)

KEGG orthology group: K08989, putative membrane protein (inferred from 100% identity to psb:Psyr_1696)

Predicted SEED Role

"Membrane protein with DUF350 domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVS8 at UniProt or InterPro

Protein Sequence (141 amino acids)

>Psyr_1696 Protein of unknown function DUF350 (Pseudomonas syringae pv. syringae B728a)
MIDALRMSLNATAVFGFVMYILVAAILFALFQFIYSRITPHKEFALIRENNSAAAVALGG
SLIGFALPASNIISYSISILDVVVWAVIAAVVQLLAFGATSLVLKGLSTRIAKGEMAAAI
YSASVAISVGLLNAACMTPSV