Protein Info for Psyr_1694 in Pseudomonas syringae pv. syringae B728a

Annotation: Rhomboid-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 52 to 75 (24 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details amino acids 161 to 181 (21 residues), see Phobius details PF01694: Rhomboid" amino acids 46 to 177 (132 residues), 81.2 bits, see alignment E=4.5e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1694)

Predicted SEED Role

"GlpG protein (membrane protein of glp regulon)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVT0 at UniProt or InterPro

Protein Sequence (184 amino acids)

>Psyr_1694 Rhomboid-like protein (Pseudomonas syringae pv. syringae B728a)
MAFSRRLKVILVLSAVLIAVQAFNSMTSNSLLQFGIMPRSLTGLRGIVFAPFLHGSIQHL
LSNLLPFIVLSWLVATEGVRRYAWVAGLVCLLGGLLVWSFGRSNIHVGASGLIFGLWAYL
LARAWYQRSIASVLIALLVLAAYSGLVFGFVPVAGVSFESHIAGALAGVCVAWLMHSRAL
LAQK