Protein Info for Psyr_1684 in Pseudomonas syringae pv. syringae B728a

Annotation: GGDEF domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 57 (21 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 118 to 135 (18 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 179 to 329 (151 residues), 101.3 bits, see alignment E=2.4e-33 PF00990: GGDEF" amino acids 182 to 327 (146 residues), 101.2 bits, see alignment E=2.6e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1684)

Predicted SEED Role

"FOG: GGDEF domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVU0 at UniProt or InterPro

Protein Sequence (354 amino acids)

>Psyr_1684 GGDEF domain protein (Pseudomonas syringae pv. syringae B728a)
MNGDMQTRIKQLLSPAIARVQCIAIVCWLVVLSVTPYLQFGLLEVLLTLGLLGACAWQCR
AVDFRVWRCMGMAFVIIVALCFSRAGHLRTATDINWSLSVAVMIILCSTLLVVYTRDYLL
VAVLAWCILSPAQGVDTDSVATLFMTLFFITSVSLGSVLNHTYTRTLRTVLSLEHQFREL
SMTDDLTAILNRRALMQALDNHVLNNSAGYFLMLDIDDFKTINDQFGHDAGDQALRVMAG
CLQKTVGSLAFGRMGGEEFGVILPMCSEDDARDYVLDLLECIRKSLAVSPLTCSAGLADI
PAAADSSAVLKTADINLYKAKRGGKDRAFWRGAQIGGQQAHGSVECDKTRALTR