Protein Info for Psyr_1677 in Pseudomonas syringae pv. syringae B728a

Annotation: General substrate transporter:Major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 90 to 113 (24 residues), see Phobius details amino acids 119 to 142 (24 residues), see Phobius details amino acids 154 to 177 (24 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 240 to 264 (25 residues), see Phobius details amino acids 277 to 299 (23 residues), see Phobius details amino acids 308 to 327 (20 residues), see Phobius details amino acids 333 to 358 (26 residues), see Phobius details amino acids 377 to 397 (21 residues), see Phobius details amino acids 403 to 421 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 18 to 231 (214 residues), 90.5 bits, see alignment E=1.2e-29 amino acids 246 to 432 (187 residues), 37.4 bits, see alignment E=1.5e-13 PF07690: MFS_1" amino acids 22 to 387 (366 residues), 108.6 bits, see alignment E=3.3e-35

Best Hits

KEGG orthology group: K03762, MFS transporter, MHS family, proline/betaine transporter (inferred from 100% identity to psb:Psyr_1677)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVU7 at UniProt or InterPro

Protein Sequence (445 amino acids)

>Psyr_1677 General substrate transporter:Major facilitator superfamily (Pseudomonas syringae pv. syringae B728a)
MTTTTVEQVDPATLKKVIVAAAIGNFVEWFDFAVYGFLATTIALQFFPSGDSSAALLKTF
AVFAVAFAFRPLGGIFFGMLGDRIGRKKTLAMTILLMAGATTLIGLLPTYAAIGVMAPVL
LTIIRCAQGFSAGGEYAGACAYLMEHAPRTQRAWYGSFVPVSTFSAFAAAAVVAYALESL
LSTEAMGNWGWRLPFLIAAPLGLVGLYLRWKLDETPAFQAVAQEHAVAHSPLKDTLRHHA
AAMCCLGAFVSLTALSFYMFTTYFATYLQVAGGLSRATALLVSLIALAFAAALCPLAGAY
SDRVGRRVTMATACILLMVVVVPSFLMASSGSFIASIIGVMLLAVGAVLCGVVTAALLSE
TFPTRTRYTASAITYNMAYTLFGGTAPLMATWLISMTGSNLSPAFYLIAVAALAMAGGMA
LPETSKISLHDVPVTGEEPVVGSIA