Protein Info for Psyr_1668 in Pseudomonas syringae pv. syringae B728a

Annotation: amidophosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 TIGR01134: amidophosphoribosyltransferase" amino acids 2 to 465 (464 residues), 534 bits, see alignment E=2e-164 PF13522: GATase_6" amino acids 65 to 195 (131 residues), 49.9 bits, see alignment E=6.8e-17 PF13230: GATase_4" amino acids 66 to 163 (98 residues), 23.1 bits, see alignment E=6.7e-09 PF13537: GATase_7" amino acids 81 to 212 (132 residues), 36.7 bits, see alignment E=8e-13 PF00156: Pribosyltran" amino acids 273 to 393 (121 residues), 33.5 bits, see alignment E=5.1e-12

Best Hits

Swiss-Prot: 91% identical to PUR1_PSEAE: Amidophosphoribosyltransferase (purF) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00764, amidophosphoribosyltransferase [EC: 2.4.2.14] (inferred from 100% identity to pst:PSPTO_3811)

MetaCyc: 65% identical to amidophosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Amidophosphoribosyltransferase. [EC: 2.4.2.14]

Predicted SEED Role

"Amidophosphoribosyltransferase (EC 2.4.2.14)" in subsystem De Novo Purine Biosynthesis (EC 2.4.2.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVV6 at UniProt or InterPro

Protein Sequence (502 amino acids)

>Psyr_1668 amidophosphoribosyltransferase (Pseudomonas syringae pv. syringae B728a)
MCGIVGIVGKSNVNQALYDALTVLQHRGQDAAGIVTSHDGRLFLRKDNGLVRDVFHQRHM
QRLVGHMGIGHVRYPTAGSSTSAEAQPFYVNSPYGITLAHNGNLTNVEQLAKEIYESDLR
HVNTNSDSEVLLNVFAHELAVRGKLQPTEEDIFAAVTDVHNRCRGGYAVVAMITGYGIVG
FRDPDAIRPIVFGQRHTDEGVEYMIASESVSLDVLGFTLIRDLAPGEAVYITEDGKLHTR
QCAANPKYAPCIFEHVYLARPDSIIDGISVYKARLRMGEKLADKILRERPDHDIDVVIPI
PDTSRTAALELANHLGVKFREGFVKNRYIGRTFIMPGQAARKKSVRQKLNAIELEFRGKN
VMLVDDSIVRGTTCKQIIQMAREAGAKNVYFCSAAPAVRYPNVYGIDMPSAHELIAHNRT
TQDVADLIGADWLVYQDLNDLIEAVSGSKKIKIDNFDCSVFDGKYVTGDIDEHYLNRIES
ARNDASKIKTQAVSAIIDLYNN