Protein Info for Psyr_1645 in Pseudomonas syringae pv. syringae B728a

Annotation: phosphate:acyl-[acyl carrier protein] acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 TIGR00182: fatty acid/phospholipid synthesis protein PlsX" amino acids 1 to 324 (324 residues), 332.7 bits, see alignment E=1.3e-103 PF02504: FA_synthesis" amino acids 1 to 313 (313 residues), 330 bits, see alignment E=1.5e-102 PF01515: PTA_PTB" amino acids 76 to 203 (128 residues), 26.8 bits, see alignment E=3.5e-10

Best Hits

Swiss-Prot: 100% identical to PLSX_PSEU2: Phosphate acyltransferase (plsX) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K03621, glycerol-3-phosphate acyltransferase PlsX [EC: 2.3.1.15] (inferred from 100% identity to psb:Psyr_1645)

Predicted SEED Role

"Phosphate:acyl-ACP acyltransferase PlsX" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVX9 at UniProt or InterPro

Protein Sequence (330 amino acids)

>Psyr_1645 phosphate:acyl-[acyl carrier protein] acyltransferase (Pseudomonas syringae pv. syringae B728a)
MGGDFGPRNIVQASLACLTATPSLHLALVGQASLIEELVSAHEAVDRSRLRVIHASEAIA
MDERPSQALRGKPDSSMRVALELVASGQAQACVSAGNTGALMALSRFVLKTLPGIDRPAM
IAAIPTRSGHCQLLDLGANVDCSAEALYQFAVMGSVLAEILGVATPRVALLNVGTEDIKG
NQQVKRAAGLLQAASGLNYIGYVEGDGLYRGEADVVVCDGFVGNVLLKSSEGLATMIAAR
IETLFQRNLLSRAVGALALPLLKRLQTDLAPARHNGASLLGLQGVVVKSHGSASVSGFQS
AIQRAVVESRENLPQRLKGRLETMFQDGRT