Protein Info for Psyr_1637 in Pseudomonas syringae pv. syringae B728a

Annotation: UDP-N-acetylmuramate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 TIGR00179: UDP-N-acetylenolpyruvoylglucosamine reductase" amino acids 11 to 335 (325 residues), 232.3 bits, see alignment E=3.6e-73 PF01565: FAD_binding_4" amino acids 25 to 156 (132 residues), 88.3 bits, see alignment E=4e-29 PF02873: MurB_C" amino acids 216 to 338 (123 residues), 95.6 bits, see alignment E=1.8e-31

Best Hits

Swiss-Prot: 100% identical to MURB_PSEU2: UDP-N-acetylenolpyruvoylglucosamine reductase (murB) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K00075, UDP-N-acetylmuramate dehydrogenase [EC: 1.1.1.158] (inferred from 100% identity to psb:Psyr_1637)

Predicted SEED Role

"UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 1.1.1.158)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.158

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVY7 at UniProt or InterPro

Protein Sequence (339 amino acids)

>Psyr_1637 UDP-N-acetylmuramate dehydrogenase (Pseudomonas syringae pv. syringae B728a)
MSLQVQSAISLKPFNTFGVDVQARLFAEAHSDDDVREALAYSARHDVPLLVIGGGSNLLL
SADVQSLVVRMASRGIRIVHEDCLESIVEAEAGEPWHPFVQSCLELGLAGLENLSLIPGT
VGAAPMQNIGAYGVEIKDVFHSLTALDRETGELREFSLQDCAFGYRDSVFKHQVARWLIL
RVRFKLSRVARLHLEYGPVRQRLDEQGIDRPTPFDVSRAICAIRSEKLPDPAVLGNAGSF
FKNPIIAAELYATIKQQHPGVVGYPQDDGQVKLAAGWLIEQAGWKGYRDGDAGVHKLQSL
VLVNYGQASGLQLLSLARRIQTDIAERFGVELEMEPNLY