Protein Info for Psyr_1632 in Pseudomonas syringae pv. syringae B728a

Annotation: ComEC/Rec2-related protein:DNA internalization-related competence protein ComEC/Rec2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 738 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 44 to 63 (20 residues), see Phobius details amino acids 230 to 249 (20 residues), see Phobius details amino acids 256 to 277 (22 residues), see Phobius details amino acids 299 to 321 (23 residues), see Phobius details amino acids 327 to 347 (21 residues), see Phobius details amino acids 359 to 377 (19 residues), see Phobius details amino acids 386 to 408 (23 residues), see Phobius details amino acids 415 to 441 (27 residues), see Phobius details amino acids 447 to 463 (17 residues), see Phobius details PF13567: DUF4131" amino acids 20 to 166 (147 residues), 109.5 bits, see alignment E=2.2e-35 TIGR00361: DNA internalization-related competence protein ComEC/Rec2" amino acids 109 to 710 (602 residues), 316.3 bits, see alignment E=3.6e-98 PF03772: Competence" amino acids 198 to 462 (265 residues), 179.9 bits, see alignment E=1e-56 TIGR00360: ComEC/Rec2-related protein" amino acids 219 to 397 (179 residues), 85.9 bits, see alignment E=3.8e-28 PF00753: Lactamase_B" amino acids 498 to 676 (179 residues), 65.3 bits, see alignment E=1.2e-21

Best Hits

KEGG orthology group: K02238, competence protein ComEC (inferred from 100% identity to psb:Psyr_1632)

Predicted SEED Role

"DNA internalization-related competence protein ComEC/Rec2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVZ2 at UniProt or InterPro

Protein Sequence (738 amino acids)

>Psyr_1632 ComEC/Rec2-related protein:DNA internalization-related competence protein ComEC/Rec2 (Pseudomonas syringae pv. syringae B728a)
MRTGMIALALGLLALRFLPALPPAWLLLLMPILALMLLPFRTYPLAFFLLGFTWACVSAQ
WALSDRLAQRLDGQTLWVQGKVVGLPSVAEGVVRFELEDAWSRRARLPARIRMAWYGGQP
VNSGERWRMAIKLKRPAGLVNPDAFDYEAWLLAQRIGATGTVVDGQLLAPARAAWRDAIR
QRLLAVDAQGREGGLAALVLGDGSGLSSTDWQVLQDTGTVHLLVISGQHIGLLAGVIYAL
VAGLARWGLWPRFLPWLPSACALAFSAALGYGLLAGFEVPVRRACVMVAMVLLWRLRFRH
LGVVWPLLLSFNAVLIFEPLVTLQPGFWLSFAAVGILILIFSGRLGAWSWWQSWTRAQWL
IAVGLLPILLALNLPISLSGPFANLLAVPWVSVIVLPPALLGTLLLPVPVVGEGLLWLAG
GALQGLFVFLGAVAAALPAWLPSAVPVWAWWLSLLGALLLLLPKGVPLRPLGWPLLLLCV
FPPLESVPEGQVDVLQLDVGQGLAILLRTRNHTLLYDAGPRFGEFDIGQRVVVPAMRKAG
VRHLDLMLISHSDADHAGGAAAVHQAFPVARVLGGELARLAPQLDARLCESGARWEWDGV
VFSTWRWEQGPEGNPASCILSVDARGERLLLAGDIDVHAERAAIDSGFDLRAHWLQSPHH
GSRTSSSKAFLRAVAPVGVLISRGRNNAFGHPHPLVMARYRGLGIASYDSAELGAVRLQL
GTFGTPQAERAQRRFWRD