Protein Info for Psyr_1613 in Pseudomonas syringae pv. syringae B728a

Annotation: septum site-determining protein MinC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 TIGR01222: septum site-determining protein MinC" amino acids 12 to 246 (235 residues), 267.2 bits, see alignment E=6.6e-84 PF05209: MinC_N" amino acids 13 to 84 (72 residues), 67.8 bits, see alignment E=7.2e-23 PF03775: MinC_C" amino acids 142 to 243 (102 residues), 109.7 bits, see alignment E=6.8e-36

Best Hits

Swiss-Prot: 100% identical to MINC_PSEU2: Probable septum site-determining protein MinC (minC) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K03610, septum site-determining protein MinC (inferred from 99% identity to psp:PSPPH_1606)

Predicted SEED Role

"Septum site-determining protein MinC" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZW11 at UniProt or InterPro

Protein Sequence (246 amino acids)

>Psyr_1613 septum site-determining protein MinC (Pseudomonas syringae pv. syringae B728a)
MSQIESQNPEPVFQLKGSMLAITVMELARTNLEALDRQLAAKVAQAPNFFSNTPLILALD
KLAPNEGPVDLPGLVRICRQHGLRTLAIRANRIEDIAAAIAVDLPVLPPSGARERVIDPV
EAEAPKKIPEKPPEPLIKPTRVITAPVRGGQQIYAQGGDLVVVAPVSPGAELLADGNIHV
YGPMRGRALAGIKGDTKARIFCQQLSAELISIAGQYKVSEDLRRDPLWGSPVQISLSGDV
LNIIRL