Protein Info for Psyr_1608 in Pseudomonas syringae pv. syringae B728a

Annotation: ice-nucleation proteins octamer repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1100 1200 1348 PF00818: Ice_nucleation" amino acids 182 to 209 (28 residues), 29.1 bits, see alignment (E = 3.1e-11) amino acids 199 to 224 (26 residues), 31.8 bits, see alignment (E = 4.3e-12) amino acids 213 to 240 (28 residues), 43.5 bits, see alignment (E = 9.4e-16) amino acids 245 to 273 (29 residues), 44 bits, see alignment (E = 6.5e-16) amino acids 277 to 304 (28 residues), 45 bits, see alignment (E = 3.2e-16) amino acids 293 to 321 (29 residues), 42 bits, see alignment (E = 2.8e-15) amino acids 309 to 337 (29 residues), 38.9 bits, see alignment (E = 2.5e-14) amino acids 325 to 348 (24 residues), 38.4 bits, see alignment (E = 3.7e-14) amino acids 341 to 369 (29 residues), 42.7 bits, see alignment (E = 1.7e-15) amino acids 357 to 385 (29 residues), 38.6 bits, see alignment (E = 3.1e-14) amino acids 373 to 400 (28 residues), 44.9 bits, see alignment (E = 3.4e-16) amino acids 389 to 417 (29 residues), 41.9 bits, see alignment (E = 2.9e-15) amino acids 405 to 433 (29 residues), 38.7 bits, see alignment (E = 3.1e-14) amino acids 421 to 448 (28 residues), 40.5 bits, see alignment (E = 8.4e-15) amino acids 437 to 465 (29 residues), 39.3 bits, see alignment (E = 1.9e-14) amino acids 453 to 480 (28 residues), 36.4 bits, see alignment (E = 1.6e-13) amino acids 469 to 496 (28 residues), 39.1 bits, see alignment (E = 2.2e-14) amino acids 485 to 513 (29 residues), 40.2 bits, see alignment (E = 1e-14) amino acids 501 to 529 (29 residues), 36.5 bits, see alignment (E = 1.5e-13) amino acids 517 to 544 (28 residues), 42.2 bits, see alignment (E = 2.4e-15) amino acids 533 to 561 (29 residues), 44.4 bits, see alignment (E = 4.8e-16) amino acids 549 to 576 (28 residues), 37.4 bits, see alignment (E = 7.7e-14) amino acids 565 to 592 (28 residues), 38.5 bits, see alignment (E = 3.4e-14) amino acids 581 to 609 (29 residues), 43.2 bits, see alignment (E = 1.1e-15) amino acids 597 to 624 (28 residues), 36.3 bits, see alignment (E = 1.6e-13) amino acids 613 to 640 (28 residues), 40 bits, see alignment (E = 1.1e-14) amino acids 629 to 657 (29 residues), 43.4 bits, see alignment (E = 1e-15) amino acids 661 to 689 (29 residues), 45.1 bits, see alignment (E = 3e-16) amino acids 677 to 705 (29 residues), 41.3 bits, see alignment (E = 4.6e-15) amino acids 693 to 721 (29 residues), 37 bits, see alignment (E = 1e-13) amino acids 709 to 736 (28 residues), 39.5 bits, see alignment (E = 1.7e-14) amino acids 741 to 768 (28 residues), 38.5 bits, see alignment (E = 3.5e-14) amino acids 773 to 801 (29 residues), 47 bits, see alignment (E = 7.7e-17) amino acids 805 to 832 (28 residues), 35.4 bits, see alignment (E = 3.3e-13) amino acids 837 to 865 (29 residues), 50.8 bits, see alignment (E = 4.9e-18) amino acids 853 to 880 (28 residues), 43.7 bits, see alignment (E = 8.1e-16) amino acids 885 to 913 (29 residues), 49 bits, see alignment (E = 1.8e-17) amino acids 906 to 929 (24 residues), 30.7 bits, see alignment (E = 9.5e-12) amino acids 933 to 961 (29 residues), 45.1 bits, see alignment (E = 2.9e-16) amino acids 959 to 977 (19 residues), 31.2 bits, see alignment (E = 6.8e-12) amino acids 981 to 1009 (29 residues), 47.5 bits, see alignment (E = 5.1e-17) amino acids 1008 to 1025 (18 residues), 31.6 bits, see alignment (E = 5.1e-12) amino acids 1029 to 1055 (27 residues), 44.1 bits, see alignment (E = 6e-16) amino acids 1045 to 1073 (29 residues), 46.3 bits, see alignment (E = 1.2e-16) amino acids 1077 to 1105 (29 residues), 41.2 bits, see alignment (E = 4.8e-15) amino acids 1093 to 1118 (26 residues), 31 bits, see alignment (E = 7.6e-12)

Best Hits

Swiss-Prot: 80% identical to ICEV_PSESX: Ice nucleation protein (inaV) from Pseudomonas syringae

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1608)

Predicted SEED Role

"ice nucleation protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZW16 at UniProt or InterPro

Protein Sequence (1348 amino acids)

>Psyr_1608 ice-nucleation proteins octamer repeat protein (Pseudomonas syringae pv. syringae B728a)
MNLDKALVLRTCANNMADHCGLIWPASGTVESKYWQSTRRHENGLVGLLWGAGTSAFLSV
HADARWIVCEVAVADIISLDEPGMVKFPRAEVVHVGDRISASHFISARQADPASTPPPTS
MTTPPPTPAAAHVTLPVAASVTLPVAEQASHEVFDVALVIAAAPSVNTLPVTTPQNLQTA
TYGSTLSGDNHSRLIAGYGSNETAGNHSDLIAGYGSTGTAGSDSSLVAGYGSTQTAGGDS
ALTAGYGSTQTAREGSNLTAGYGSTGTAGSDSSLIAGYGSTQTSGEDSSLTAGYGSTQTA
QEGSNLTAGYGSTGTAGSDSSLIAGYGSTQTSGGDSSLTAGYGSTQTAQEGSNLTAGYGS
TGTAGSDSSLIAGYGSTQTSGEDSSLTAGYGSTQTAQEGSNLTAGYGSTGTAGSDSSLIA
GYGSTQTSGGDSSLTAGYGSTQTAQEGSNLTSGYGSTGTAGADSSLIAGYGSTQTSGSDS
ALTAGYGSTQTAQQGSNLTAGYGSTGTAGSDSSLIAGYGSTQTSGSDSSLTAGYGSTQTA
QEGSNLTAGYGSTGTAGVDSSLIAGYGSTQTSGSDSALTAGYGSTQTAQEGSNLTAGYGS
TGTAGADSSLIAGYGSTQTSGSDSALTAGYGSTQTAQEGSNLTAGYGSTGTAGADSSLIA
GYGSTQTSGSESSLTAGYGSTQTAREGSTLTAGYGSTGTAGADSSLIAGYGSTQTSGSES
SLTAGYGSTQTAQQGSVLTSGYGSTQTAGAASNLTTGYGSTGTAGHESFIIAGYGSTQTA
GHKSILTAGYGSTQTARDGSDLIAGYGSTGTSGSSSSLIAGYGSTQTASYKSMLTAGYGS
TQTAREHSDLVAGYGSTSTAGSNSSLIAGYGSTQTAGFKSILTAGYGSTQTAQERSDLVA
GYGSTSTAGYSSSLIAGYGSTQTAGYGSTLTTGYGSTQTAQENSSLTTGYGSTSTAGYSS
SLIAGYGSTQTAGYESTLTAGYGSTQTAQERSDLVTGYGSTSTAGYASSLIAGYGSTQTA
GYESTLTAGYGSTQTAQENSSLTTGYGSTSTAGFASSLIAGYGSTQTAGYKSTLTAGYGS
TQTAEYGSSLTAGYGSTATAGQDSSLIAGYGSSLTSGIRSFLTAGYGSTLIAGLRSVLIA
GYGSSLTSGIRSTLTAGYGSNQIASYGSSLIAGHESIQVAGNKSMLIAGKGSSQTAGFRS
TLIAGAGSVQLAGDRSRLIAGADSNQTAGDRSKLLAGNNSYLTAGDRSKLTGGHDCTLMA
GDQSRLTAGKNSILTAGARSKLIGSEGSTLSAGEDSTLIFRLWDGKRYRQLVAKTGENGV
EADIPYYVNEDDDIVDKPDEEDDWIEVE