Protein Info for Psyr_1604 in Pseudomonas syringae pv. syringae B728a

Annotation: Binding-protein-dependent transport systems inner membrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 108 to 130 (23 residues), see Phobius details amino acids 148 to 168 (21 residues), see Phobius details amino acids 189 to 218 (30 residues), see Phobius details amino acids 250 to 272 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 76 to 274 (199 residues), 43.7 bits, see alignment E=1.3e-15

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to psb:Psyr_1604)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZW20 at UniProt or InterPro

Protein Sequence (280 amino acids)

>Psyr_1604 Binding-protein-dependent transport systems inner membrane component (Pseudomonas syringae pv. syringae B728a)
MTTFSRGKWLGLLCLLPFAVFFIVFQIAPLLWVAIHSLQSDAGWGWENFTRAFSSKFYRQ
AIQYSLEISFWSSLFGIIISVLGAYSLRKVDSRLRDFVNSFANMTSNFAGVPLAFAFIIL
LGFNGALTLILKQTGIIDDFNLYSKTGLIILYTYFQIPLGVLLLYPAFDAVREDWNESAA
LLGASSYQFWRYIGLPVLTPALLGTFVILLANALGAYATVYALTTGNFNVLPIRIAAMVA
GDITLDPNMASALAMILVGLMTLVTVVHQWLLRRSYHVTR