Protein Info for Psyr_1602 in Pseudomonas syringae pv. syringae B728a

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 PF00005: ABC_tran" amino acids 20 to 161 (142 residues), 136.1 bits, see alignment E=1.9e-43 PF08402: TOBE_2" amino acids 257 to 327 (71 residues), 33.2 bits, see alignment E=7e-12

Best Hits

Swiss-Prot: 46% identical to Y4FO_SINFN: Uncharacterized ABC transporter ATP-binding protein y4fO (NGR_a03670) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02052, putative spermidine/putrescine transport system ATP-binding protein (inferred from 100% identity to psb:Psyr_1602)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotA (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZW22 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Psyr_1602 ABC transporter (Pseudomonas syringae pv. syringae B728a)
MSFVSIENLQKSYASTSVFSDINCSIAKGEFVTLLGPSGCGKSTLLRCIAGLTPVNSGRI
LLDGSDLVPLTPQKRNIGMVFQSYALFPNMTVEQNVAFGLRIQKVSADESTRRVAEILRM
VELHDFATRYPHQLSGGQCQRVALARSLVTRPRLLLLDEPLSALDARIRKNLREQIRAIQ
RELGLTTIFVTHDQEEALTMSDRIFLMNQGRIVQSGDAETLYTAPVDVFAAGFIGNYNLL
EADDATRLMQRPINSRVAIRPESIQLSLTGELEGEIRSHSLLGNVIRYRVQARGVKLVVD
VLNRSADDLHPDGRRVTLNIEPSALCALD