Protein Info for Psyr_1601 in Pseudomonas syringae pv. syringae B728a

Annotation: HAD-superfamily hydrolase, subfamily IB (PSPase-like):HAD-superfamily subfamily IB hydrolase, hypothetical 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 TIGR01490: HAD hydrolase, family IB" amino acids 3 to 199 (197 residues), 168.2 bits, see alignment E=2.7e-53 TIGR01488: HAD phosphoserine phosphatase-like hydrolase, family IB" amino acids 3 to 189 (187 residues), 99.8 bits, see alignment E=1.7e-32 PF12710: HAD" amino acids 4 to 187 (184 residues), 125.3 bits, see alignment E=2e-40

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1601)

Predicted SEED Role

"Phosphoserine phosphatase (EC 3.1.3.3)" in subsystem Glycine and Serine Utilization or Serine Biosynthesis (EC 3.1.3.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.3

Use Curated BLAST to search for 3.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZW23 at UniProt or InterPro

Protein Sequence (217 amino acids)

>Psyr_1601 HAD-superfamily hydrolase, subfamily IB (PSPase-like):HAD-superfamily subfamily IB hydrolase, hypothetical 2 (Pseudomonas syringae pv. syringae B728a)
MPLAIFDLDETLIGGDCATLWSEQMGRLGWVDSTSFMQRNDELMAAYSEGKLAMEDYMAF
SLEPMAGRTPEEIEHLVGPWVEDVIEPIIYSDACTCIAKHRAKGDRILVISASGVHLVKP
IAERLGIDEVLGIELDVQHGVYSGATVGVLTYREGKITRLMEWLDAEGENLEGASFYSDS
RNDLPLLLKVDHPNVVNPDAVLLEHARKAGWPVHDWS