Protein Info for Psyr_1554 in Pseudomonas syringae pv. syringae B728a

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 transmembrane" amino acids 46 to 64 (19 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 196 to 227 (32 residues), see Phobius details amino acids 249 to 271 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1554)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZW70 at UniProt or InterPro

Protein Sequence (343 amino acids)

>Psyr_1554 hypothetical protein (Pseudomonas syringae pv. syringae B728a)
MGDESGVEKKTRGVDHAEPGARKSVCSREQPMITHKRAGGTLKSSIIVPILIMFFLTLAI
TGFANHTHQRKPFFTRIPRWTFNYKPLGWTLMDYLAATTSVSILGLIYLLLFEAIQIKVP
KFLALVVIGCICTCTVGMATLYFNLVDTYKKISTPLTIISTTATIFIAVISSILADGHIE
RLTGVEAGKFPNAQKAMILTSTVIIWASIIFVASALFTTASSIYLFWKTGPGSSINLNQA
DDKGRTPFHAFNLLIGITFFFGILSGAYSTAINDLSERRLKYWLVGSSFHFAPEHCGIRE
KPMDSQIALIGDGKAVLATSSLTEIYRFDLIACPQASEPKPTY