Protein Info for Psyr_1547 in Pseudomonas syringae pv. syringae B728a

Annotation: glycine cleavage system transcriptional repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 PF13740: ACT_6" amino acids 10 to 84 (75 residues), 69 bits, see alignment E=1.3e-23

Best Hits

KEGG orthology group: K03567, glycine cleavage system transcriptional repressor (inferred from 99% identity to pst:PSPTO_3954)

Predicted SEED Role

"Glycine cleavage system transcriptional antiactivator GcvR" in subsystem Glycine cleavage system or Orphan regulatory proteins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZW76 at UniProt or InterPro

Protein Sequence (187 amino acids)

>Psyr_1547 glycine cleavage system transcriptional repressor (Pseudomonas syringae pv. syringae B728a)
MSSTPTVREQFLVISALGANPMELTNVLCRASHENRCSVVTSRLTRHGECSALILQVSGS
WDALARLETGLASLSKKHAFTTSVVRSATLENRPEALPYVAYVSSAYRPDIINELCQFFI
DHNVELENLICDTYQAPQTGGTMLNATFTVTLPAGTQISWLRDQFLDFADALNLDALIEP
WRPQAPM