Protein Info for Psyr_1545 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function UPF0118

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 transmembrane" amino acids 19 to 52 (34 residues), see Phobius details amino acids 69 to 93 (25 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 217 to 236 (20 residues), see Phobius details amino acids 242 to 269 (28 residues), see Phobius details amino acids 278 to 301 (24 residues), see Phobius details amino acids 307 to 334 (28 residues), see Phobius details PF01594: AI-2E_transport" amino acids 22 to 346 (325 residues), 225.5 bits, see alignment E=6e-71

Best Hits

KEGG orthology group: K03548, putative permease (inferred from 100% identity to psb:Psyr_1545)

Predicted SEED Role

"Putative permease PerM (= YfgO)" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZW78 at UniProt or InterPro

Protein Sequence (356 amino acids)

>Psyr_1545 Protein of unknown function UPF0118 (Pseudomonas syringae pv. syringae B728a)
MFNVLRNWVQRYFSDEEAVVLAVLLFLAFTLVLTLGGMLAPVLAGLVLAFLMHGLVSALE
RLRMPEMAAVGLVFTLFIGVLLVFLLVLVPLLWHQLITLFNEAPGMLAKWQSVLLLLPER
YPHLVSDEQVLLAIEVARGEVGKIGQLALTFSISSLPLLVNLMIYLVLVPILVFFFLKDR
HMIGRWARGYLPRERALINRVADEMKRQIANYIRGKVIEIFICGGVTYIAFAALGLNYAA
LLAMLVGISVVVPYVGAVVVTVPVALIGLFQWGWGDQFIYLMIAHGIIQALDGNVLVPLL
FSEAVNLHPVAIICAVLLFGGLWGFWGIFFAIPLATLFKAVLDAWPRNEPTVAPLL