Protein Info for Psyr_1544 in Pseudomonas syringae pv. syringae B728a

Annotation: SirA-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 83 PF01206: TusA" amino acids 14 to 82 (69 residues), 76.5 bits, see alignment E=6e-26

Best Hits

Swiss-Prot: 53% identical to TUSA_ALLVD: Sulfur carrier protein TusA (tusA) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)

KEGG orthology group: None (inferred from 95% identity to psp:PSPPH_1533)

MetaCyc: 53% identical to TusA sulfur-carrier protein (Allochromatium vinosum)
2.8.1.-

Predicted SEED Role

"Rhodanese-like domain protein"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZW79 at UniProt or InterPro

Protein Sequence (83 amino acids)

>Psyr_1544 SirA-like protein (Pseudomonas syringae pv. syringae B728a)
MSDAVVRPEACDAELDASGLNCPLPLLKAKMELNRLASGAVLKVIATDAGSQRDFRTFAR
LAGHELLHEEVDAGIYRYWLRKA