Protein Info for Psyr_1541 in Pseudomonas syringae pv. syringae B728a

Annotation: DedA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 transmembrane" amino acids 14 to 34 (21 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 128 to 149 (22 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details PF09335: VTT_dom" amino acids 27 to 147 (121 residues), 67.4 bits, see alignment E=8.5e-23

Best Hits

Swiss-Prot: 47% identical to YOHD_ECOLI: Inner membrane protein YohD (yohD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1541)

Predicted SEED Role

"DedA family inner membrane protein YohD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZW82 at UniProt or InterPro

Protein Sequence (193 amino acids)

>Psyr_1541 DedA (Pseudomonas syringae pv. syringae B728a)
MFEHLDLNALIAAYGYWVIFLGCLLEGETVLILGGMAAHQGALQLLQVIGLATLGGMLGD
QLLFWTGRYSGERLLPRLKRHQSAIKRVEGLIQRYPTTSVFAVRFLYGMRLVGPMVIGAS
GLSPWRFALINVLSAAVWATLFVCAGYWAGEALQHLLGDLKPYRLPIFLAVVALVILAAL
VRYVHRRSRATDR