Protein Info for Psyr_1538 in Pseudomonas syringae pv. syringae B728a

Annotation: Propionyl-CoA carboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 107 to 122 (16 residues), see Phobius details amino acids 130 to 154 (25 residues), see Phobius details PF01039: Carboxyl_trans" amino acids 54 to 441 (388 residues), 182.2 bits, see alignment E=8.2e-58

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1538)

Predicted SEED Role

"Methylcrotonyl-CoA carboxylase carboxyl transferase subunit (EC 6.4.1.4)" in subsystem HMG CoA Synthesis or Leucine Degradation and HMG-CoA Metabolism or Serine-glyoxylate cycle (EC 6.4.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.4

Use Curated BLAST to search for 6.4.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZW85 at UniProt or InterPro

Protein Sequence (455 amino acids)

>Psyr_1538 Propionyl-CoA carboxylase (Pseudomonas syringae pv. syringae B728a)
MSVSERRVSRLFDPGSFKEDLEGQNTHFICGAGTIHSIKTYVAMSRGRDCEFQSSRQWST
AQQIIKTVGLARAAEAPLIYIQDKIGGNNDTEGFDTARVFSSDMSSLLLSPSGMGSVSAS
LAELAKLNLLMSVILGPTSGPLALPVMLADLVLMTRRGALCMGRPDMVKAMLAQQTDLYS
LGGSDIHSTASGSVHLVFDDEADLFADLRKLLLYLIAGKSSTYGEFSTPLEVDFNRLLPP
SHNIPFDVQHLVRSFVDSDSLIEIGASHAPEVLVGLASLQGQVFAVVANNSAHGGGVIYK
RTARKMIHVIDLAGKMSLPILFIADIPGIMIGEEAERDGIFAAVADLFRAHTRCKVKKLL
LVARKAYTGGVYAMSGPGFEPVAVLAYPDANIGVFSTLTMEKIIKSSSMTDAQRAVVSAL
DEEIRSPLLLKDKGLITDVISVRDTRQAVFKYLFH