Protein Info for Psyr_1506 in Pseudomonas syringae pv. syringae B728a

Annotation: Cation efflux protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 102 to 125 (24 residues), see Phobius details amino acids 132 to 154 (23 residues), see Phobius details amino acids 183 to 203 (21 residues), see Phobius details amino acids 209 to 230 (22 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 30 to 310 (281 residues), 214.7 bits, see alignment E=8.4e-68 PF01545: Cation_efflux" amino acids 35 to 236 (202 residues), 113.5 bits, see alignment E=5.6e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1506)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZWB6 at UniProt or InterPro

Protein Sequence (317 amino acids)

>Psyr_1506 Cation efflux protein (Pseudomonas syringae pv. syringae B728a)
MNAGSNFMNSNTSFTHEHVYLGSAHDENAKRTLWVVILTVVMMVGEITAGYLTGSMALLA
DGFHMATHAGALGIAAAAYAYAKRHASSTRFSFGTGKVGDLGGFASALILGLVSLGIGVE
SIIRLFQPTNVQFGTATLIAIVGLGVNIVSALLLGHGHRHDHGHGHHDHDHSPHGGDNNL
RSAYIHVIADALTSVLAIAALLAGRYLGWVWLDPAMGIVGAIVIARWAWSLMGATAGVLL
DQTDDHVADEIRELVEQAGDAKITDLHVWRVGPEAHAAIVSVLGASTTNADSIRDRLKPV
HEVSHLTIEFRAALPAT