Protein Info for Psyr_1501 in Pseudomonas syringae pv. syringae B728a

Annotation: NADPH-dependent FMN reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 TIGR02690: arsenical resistance protein ArsH" amino acids 12 to 230 (219 residues), 400.9 bits, see alignment E=4.9e-125 PF03358: FMN_red" amino acids 38 to 181 (144 residues), 110.8 bits, see alignment E=2.4e-36

Best Hits

Swiss-Prot: 72% identical to ARREH_ACIF2: NADPH-dependent FMN reductase ArsH (arsH) from Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455)

KEGG orthology group: K11811, arsenical resistance protein ArsH (inferred from 100% identity to psb:Psyr_1501)

MetaCyc: 76% identical to ArsH (Pseudomonas putida KT2440)

Predicted SEED Role

"Arsenic resistance protein ArsH" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZWC1 at UniProt or InterPro

Protein Sequence (244 amino acids)

>Psyr_1501 NADPH-dependent FMN reductase (Pseudomonas syringae pv. syringae B728a)
MNDSVKTDPSDFPSLDVSLLNIPTQDQLAKGEPPTHSPRILLLYGSTRERSFSRLLTQEA
ARILELMGAETAIFDPSGLPLPDDAPVGHPKVQELRNLVMWSEGQVWCSPERHGSMSAVF
KAQIDWIPLALGAVRPSQGKTLAVMQVCGGSQSFNTVNQMRVLGRWMRMVTIPNQSSVPK
AFLEFDETDRMKPSSYYDRVVDVMEELIKFTLLIRGREEYLVNRYSERKESAEALSQRVN
QRPS