Protein Info for Psyr_1500 in Pseudomonas syringae pv. syringae B728a

Annotation: GCN5-related N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 PF13302: Acetyltransf_3" amino acids 7 to 140 (134 residues), 32.6 bits, see alignment E=3.1e-11 PF13420: Acetyltransf_4" amino acids 8 to 157 (150 residues), 90.2 bits, see alignment E=3.7e-29 PF13673: Acetyltransf_10" amino acids 41 to 146 (106 residues), 31.8 bits, see alignment E=3.1e-11 PF00583: Acetyltransf_1" amino acids 52 to 139 (88 residues), 51.9 bits, see alignment E=2.3e-17 PF13508: Acetyltransf_7" amino acids 55 to 140 (86 residues), 31.3 bits, see alignment E=5.4e-11

Best Hits

Swiss-Prot: 42% identical to PAT_STRVT: Phosphinothricin N-acetyltransferase (pat) from Streptomyces viridochromogenes (strain DSM 40736 / JCM 4977 / BCRC 1201 / Tue 494)

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 100% identity to psb:Psyr_1500)

MetaCyc: 42% identical to demethyl-phosphinothricin N-acetyltransferase (Streptomyces hygroscopicus)
Phosphinothricin acetyltransferase. [EC: 2.3.1.183]; 2.3.1.183 [EC: 2.3.1.183]

Predicted SEED Role

"phosphinothricin N-acetyltransferase, putative"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.183

Use Curated BLAST to search for 2.3.1.183

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZWC2 at UniProt or InterPro

Protein Sequence (184 amino acids)

>Psyr_1500 GCN5-related N-acetyltransferase (Pseudomonas syringae pv. syringae B728a)
MSVSSMVRSASPTDAAAIQGIYAPMVERTAISFELEPPTVEEMAHRIESTLSKYPYLVAE
REGQVVGYAYASQHRTREAYQWSVDVTVYVAPQAHRSGIARVLYARLIPILERQGFHTAY
AGIALPNAGSVGLHEALGFEHLGTYTEVGFKHGKWHDVGYWRKRLNSATPPGPIVPFSQL
IEAR