Protein Info for Psyr_1498 in Pseudomonas syringae pv. syringae B728a

Annotation: Heavy metal sensor kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details PF21085: CusS" amino acids 2 to 153 (152 residues), 50.9 bits, see alignment E=5e-17 TIGR01386: heavy metal sensor kinase" amino acids 3 to 451 (449 residues), 447 bits, see alignment E=4.2e-138 PF00672: HAMP" amino acids 178 to 230 (53 residues), 51.1 bits, see alignment 3.5e-17 PF26769: HAMP_PhoQ" amino acids 184 to 230 (47 residues), 27.7 bits, see alignment 5.3e-10 PF00512: HisKA" amino acids 236 to 301 (66 residues), 51.8 bits, see alignment E=1.7e-17 PF02518: HATPase_c" amino acids 345 to 451 (107 residues), 91.5 bits, see alignment E=1.2e-29

Best Hits

Swiss-Prot: 95% identical to COPS_PSEUB: Sensor protein CopS (copS) from Pseudomonas syringae pv. tomato

KEGG orthology group: K07644, two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC: 2.7.13.3] (inferred from 100% identity to psb:Psyr_1498)

Predicted SEED Role

"Heavy metal sensor histidine kinase" in subsystem Cobalt-zinc-cadmium resistance

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZWC4 at UniProt or InterPro

Protein Sequence (459 amino acids)

>Psyr_1498 Heavy metal sensor kinase (Pseudomonas syringae pv. syringae B728a)
MKPGSLTLRLSLLFVVAVAVVLIIVGVAFNELSRHHFRALDAQTLGEKLEAINQIAIESG
SNPDLLEARWHTLLGAHPDLSAVFLKTDGTPFFAEPPQSAAPSLTQATQRDGVWEWENKG
RMFRALTASVSLPTASPPLTVWLVLDVTTHMHFFAMLERWFWGVLLASTALSAALGWLVA
KNGLRPVARVTQTAASMSAGSLKERIPLGPVPDELRELITAFNSMLGRLDDSFVRLSNFS
ADIAHELRTPISNLRTHTEVILAKKRAPEVYEENLSSNLEELNRLSGIIDGMLFLAKSDN
GLIVPEAVELDLRTVISKLFGYYEFLAEDKGIQLQASGNASIFADSVMIDRIVSNLLSNA
LRYTPSGETIKVSIHDHGGRVELRLENPGPEIAPQHLDRIFDRFYRVDPARREGAGNAGL
GLAIARSLMQAHGGTISCTSHEGRTTFILTFVRSSGPRT