Protein Info for Psyr_1496 in Pseudomonas syringae pv. syringae B728a

Annotation: Copper resistance D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 47 to 68 (22 residues), see Phobius details amino acids 94 to 114 (21 residues), see Phobius details amino acids 120 to 138 (19 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details amino acids 233 to 257 (25 residues), see Phobius details amino acids 280 to 300 (21 residues), see Phobius details PF05425: CopD" amino acids 193 to 299 (107 residues), 80.7 bits, see alignment E=4.8e-27

Best Hits

Swiss-Prot: 93% identical to COPD_PSEUB: Copper resistance protein D (copD) from Pseudomonas syringae pv. tomato

KEGG orthology group: K07245, putative copper resistance protein D (inferred from 100% identity to psb:Psyr_1496)

Predicted SEED Role

"Copper resistance protein CopD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZWC6 at UniProt or InterPro

Protein Sequence (310 amino acids)

>Psyr_1496 Copper resistance D (Pseudomonas syringae pv. syringae B728a)
MEDPLSIAVRFALYTDLMMLFGLALFGLYSLRGAERRSGAVLPFRPLLSTTVLIGLLLSV
ISIVLMAKAMSGASEWLEAVPHVKMMVTQTELGTAWLIRMSALVGAAVAIAFNLRIPMAS
LLMVSLLASVALATLAWMGHGAMDEDSRRFWHFSADILHLWSSGGWFGALVAFALMLRPN
KVETLQSVQVLSRTLTGFERAGTVIVALIVITGVVNYLFIVGPQVSGVVKSTYGVLLLGK
LALFGLMVGLASANRFILSPAFERAVHHGQYARAARSIRYSMALELAAAVVVLGLIAWLG
TLSPEMEAGM