Protein Info for Psyr_1453 in Pseudomonas syringae pv. syringae B728a

Annotation: conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 transmembrane" amino acids 28 to 52 (25 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 156 to 179 (24 residues), see Phobius details amino acids 199 to 217 (19 residues), see Phobius details amino acids 223 to 245 (23 residues), see Phobius details TIGR03747: integrating conjugative element membrane protein, PFL_4697 family" amino acids 16 to 249 (234 residues), 341.7 bits, see alignment E=1.1e-106 PF14348: DUF4400" amino acids 51 to 246 (196 residues), 265.7 bits, see alignment E=1.1e-83

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1453)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZWG9 at UniProt or InterPro

Protein Sequence (249 amino acids)

>Psyr_1453 conserved hypothetical protein (Pseudomonas syringae pv. syringae B728a)
MADVADRAKQQQDHEQSFIGSLFTLPFRFAAVMFLSLGGAIIVEWICMYFFWPEAGWQHA
RAMLDHELSWLSKGFLQSVVVQEPGRTATWLVQTTYDWLVVKTGLQDWVQHTSDYAATGQ
RSRGFDMRYMLGVGVSKFQDYGLAALYTTLVFCVRLVILTLAIPLFVMTAFVGFVDGLVR
RDLRRFGAGRESSYLYHKARATMVPLVIVPWSLYLALPFSVSPLLVLLPCAALLGLAVSI
TASSFKKYL