Protein Info for Psyr_1445 in Pseudomonas syringae pv. syringae B728a

Annotation: conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 307 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR03749: integrating conjugative element protein, PFL_4704 family" amino acids 16 to 287 (272 residues), 374.5 bits, see alignment E=1.4e-116 PF11920: DUF3438" amino acids 26 to 293 (268 residues), 334.6 bits, see alignment E=1.8e-104

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1445)

Predicted SEED Role

"FIG00958851: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZWH7 at UniProt or InterPro

Protein Sequence (307 amino acids)

>Psyr_1445 conserved hypothetical protein (Pseudomonas syringae pv. syringae B728a)
MSVLRVLTCSTLLMVLAGNAQVASAVEILRWERLPLAIPLRINQERIVFVDQNVRVGLPR
SLTEKLRVQSTGGAIYLFAKEAIEPTRLQLQNAKTGEIILVDIAATEAQTDQPALEPVKI
VEGETSSARYGGAATARSAKATTKSTDSTSRSNDEEDEPEEVVKRETPVPVVLTRYAAQM
LYAPLRTVEPVDGIAQVKVERSLDLTTLLPTLPVKSTPLGAWRLDDFWVTAVKLQNQTAQ
RITLDPRELMGEFVTAAFQHPYLGSRGDASDTTTLYLVTRGHGLTQAAVFSATQADPRAA
QGAKHER