Protein Info for Psyr_1422 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function DUF1528:Relaxase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 634 PF07514: TraI_2" amino acids 20 to 334 (315 residues), 474.4 bits, see alignment E=1.5e-146 TIGR03760: integrating conjugative element relaxase, PFGI-1 class" amino acids 20 to 236 (217 residues), 288.5 bits, see alignment E=1.7e-90 PF07515: TraI_2_C" amino acids 501 to 623 (123 residues), 157.5 bits, see alignment E=1.7e-50

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1422)

Predicted SEED Role

"Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZWJ9 at UniProt or InterPro

Protein Sequence (634 amino acids)

>Psyr_1422 Protein of unknown function DUF1528:Relaxase (Pseudomonas syringae pv. syringae B728a)
MLSFFTRRKASPISSNAAAGFFKPESPDALLSTSRRRQLIENIWQRTSLPREQFETLYMQ
AFKSYAALVQHLPASENHHHAYHGGMLDHGLEIVAYALKIRQMYLLPIGAPPESQAAQSE
AWSAASAYGALVHDLGKIAVDVKVELADGTIWHPWHGPLDQPYRFKYVKGRDYRLHGAAS
SLIYSNVIPAKALDWLSGFPELWSQLVFAFAGQYEHADILGEIVSQADQASVAQELGGNP
GRAMSAPKQSIQRQLAEGLRMLVADKFKLNQPDGPSDGWLTQEGLWLVSKPAVDQLRALL
LSQGIEHIPSSNAPMFNLLQDQAIIQPNGEGKAIWKASIDNGRGWKNTFTVLKIAPALIW
PNTTDRPETYTGTLTVESAPMADDNEQVPAGGDESQPVNSKNTPAASASAARPAPKQAPA
AAKDFDALDELLDLFPDPVATAPTQPAPESIGDDDQIPFLPPPPAATSLSQPRQLVGNKA
ENHTAPVEEPAKVLPEGSSSHGLNFLTWLKGGVISHRIIINDAKARVHTVDGTAFLVSPD
IFKRYALEQPGIEREARERDLEAWQVVQRSFEKLKKHRKTGAGLNIWTCLVKGPRKSKQL
RGYLLIEPTDVFSEVPYDNPVISLAELVDKDTSE