Protein Info for Psyr_1407 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function DUF28

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 TIGR01033: DNA-binding regulatory protein, YebC/PmpR family" amino acids 1 to 238 (238 residues), 329 bits, see alignment E=9.9e-103 PF20772: TACO1_YebC_N" amino acids 5 to 75 (71 residues), 109.4 bits, see alignment E=1e-35 PF01709: Transcrip_reg" amino acids 83 to 237 (155 residues), 206.5 bits, see alignment E=2e-65

Best Hits

Swiss-Prot: 100% identical to Y1407_PSEU2: Probable transcriptional regulatory protein Psyr_1407 (Psyr_1407) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: None (inferred from 98% identity to psp:PSPPH_3775)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZWL4 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Psyr_1407 Protein of unknown function DUF28 (Pseudomonas syringae pv. syringae B728a)
MAGHSKWANIKHRKERQDAKKGKIFTKWIRELTVAARQGGGDPGSNPRLRLALDKALGAN
MTRDTIDRAVARGVGASDGDDVEELGYEGYGPGGVAIMVETMTDNRNRTAAAVRHAFTKC
GGNLGTDGSVAYLFDRKGQISFAAGVDEDSLIEAAMEADADDVVTNEDGSIDVFTSFSGF
YAVRNALEAAGFKAADAEIVMLPTTSAVLDLETAEKVLKLIDMLEDLDDVQNVYSNAEIP
DEVMEQLG