Protein Info for Psyr_1373 in Pseudomonas syringae pv. syringae B728a

Annotation: Peptidoglycan-binding LysM:Peptidase M23B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 288 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF01476: LysM" amino acids 60 to 101 (42 residues), 51.6 bits, see alignment 7.5e-18 PF01551: Peptidase_M23" amino acids 188 to 281 (94 residues), 113 bits, see alignment E=6.1e-37

Best Hits

Swiss-Prot: 66% identical to NLPD_PSEAE: Lipoprotein NlpD/LppB homolog (PA3623) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06194, lipoprotein NlpD (inferred from 100% identity to psb:Psyr_1373)

Predicted SEED Role

"Lipoprotein NlpD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZWP8 at UniProt or InterPro

Protein Sequence (288 amino acids)

>Psyr_1373 Peptidoglycan-binding LysM:Peptidase M23B (Pseudomonas syringae pv. syringae B728a)
MSLTVIQQLRSSRSYQRLVIGIALSVLLVGCSSSPSGGVRVVDRNGNAVAQRPTVTTGQY
VVRRGDTLFSIAFRYGWDWKALAARNQIPEPFTIKPGQTIRFDGRSSSTPNVVSTSGAGR
PVTSTSTSTGSSGSVKTTVMSKPVAVVPVVIPPSATTGTGPAGKSPTGWTWPSSGILIGK
FSSNGSLNKGIDIAGDLGQPVLAASDGSVVYAGSGLRGYGELIIIKHSDTYVSAYGHNRR
LLVREGQQVKAGQTIAEMGSTGTDRVKLHFEIRRQGKPVDPLGFLPRR