Protein Info for Psyr_1342 in Pseudomonas syringae pv. syringae B728a

Annotation: methionine aminopeptidase, type I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 67% identical to MAP1_ECOL6: Methionine aminopeptidase (map) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K01265, methionyl aminopeptidase [EC: 3.4.11.18] (inferred from 100% identity to psb:Psyr_1342)

MetaCyc: 67% identical to methionine aminopeptidase (Escherichia coli K-12 substr. MG1655)
Methionyl aminopeptidase. [EC: 3.4.11.18]

Predicted SEED Role

"Methionine aminopeptidase (EC 3.4.11.18)" (EC 3.4.11.18)

MetaCyc Pathways

Arg/N-end rule pathway (eukaryotic) (8/14 steps found)
Ac/N-end rule pathway (6/21 steps found)

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.18

Use Curated BLAST to search for 3.4.11.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZWS9 at UniProt or InterPro

Protein Sequence (260 amino acids)

>Psyr_1342 methionine aminopeptidase, type I (Pseudomonas syringae pv. syringae B728a)
MTITLKTPEDIEKMRIAGRLAADVLEMIAPYVKPGVTTEELDRLCHDYIVNEQKAIPAPL
NYKGFPKSICTSINQVVCHGIPSDKKLKDGDSLNIDVTVIKDGYHGDTSRMFHVGTVPVW
AERLSKVTQECLYKAIEIVKPGTRLGDIGAVIQKHAEKNGFSVVREFCGHGIGKVFHEEP
QVMHFGEAGTGIELQEGMTFTIEPMINQGRPETKILGDGWTAITKDRKLSAQWEHTLLVT
ADGYEIFTLRSDDTIAQKAP