Protein Info for Psyr_1335 in Pseudomonas syringae pv. syringae B728a

Annotation: Aminotransferase, class V

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00266: Aminotran_5
  • amino acids 35 to 400 (366 residues), 459.4 bits, E=9.3e-142
• PF00155: Aminotran_1_2
  • amino acids 80 to 393 (314 residues), 38 bits, E=1.2e-13

Best Hits

Swiss-Prot: 77% identical to CSD_PSEPK: Probable cysteine desulfurase (csdA) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K01766, cysteine sulfinate desulfinase [EC: 4.4.1.-] (inferred from 100% identity to psb:Psyr_1335)

Predicted SEED Role

"Cysteine desulfurase CsdA-CsdE (EC 2.8.1.7), main protein CsdA" in subsystem Alanine biosynthesis (EC 2.8.1.7)

MetaCyc Pathways

• superpathway of thiamine diphosphate biosynthesis II (10/11 steps found)
• superpathway of thiamine diphosphate biosynthesis I (9/10 steps found)
• superpathway of L-alanine biosynthesis (4/4 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (6/7 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (5/6 steps found)
• L-alanine biosynthesis III (1/1 steps found)
• L-cysteine degradation IV (1/1 steps found)
• molybdopterin biosynthesis (4/6 steps found)
• cytidylyl molybdenum cofactor sulfurylation (1/2 steps found)
• bis(guanylyl molybdopterin) cofactor sulfurylation (1/3 steps found)
• tRNA-uridine 2-thiolation (mammalian mitochondria) (1/4 steps found)
• tRNA-uridine 2-thiolation (yeast mitochondria) (1/4 steps found)
• tRNA-uridine 2-thiolation (thermophilic bacteria) (1/5 steps found)
• tRNA-uridine 2-thiolation and selenation (bacteria) (5/11 steps found)
• [2Fe-2S] iron-sulfur cluster biosynthesis (4/10 steps found)
• tRNA-uridine 2-thiolation (cytoplasmic) (1/8 steps found)

KEGG Metabolic Maps

• Thiamine metabolism
• Tryptophan metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.7

Use Curated BLAST to search for 2.8.1.7 or 4.4.1.-

Sequence Analysis Tools

See Q4ZWT6 at UniProt or InterPro

Protein Sequence (413 amino acids)

>Psyr_1335 Aminotransferase, class V (Pseudomonas syringae pv. syringae B728a)
MALNPPPHAGRTMPLFSPWRGDFPAIAALQRQGQTYLDNAATTQKPQALIDALTHYYANG
AANVHRAQHLPGAHATQAFEASRGKAARWLNAGENGQIIFTHGATSALNLLAYGLEHEFA
AGDEIAISALEHHANLLPWQQLAQRRGLKLVVLPLDIDGVIDCDAAANLIGPRTRLLAVT
QLSNVLGTWQPLARLIALAKTQGAITVVDGSQGVVHGRHDVQALGCDFYVFSSHKLYGPE
GLGVLYGCNEALPSLAHWQFGGEMVLTADYQHAKFRPAPLGFEAGTPPIASVIGLGATLA
YLDSLDHQAVAEHEARLHRRLLEGLQQRNGIQVLGSPDLALVSFVVDDVHNADVAHLLTE
QGIAVRAGHHCAMPLFKTLGLPGAIRVSLALYNDSDDLLQFFSALDQALELLR