Protein Info for Psyr_1332 in Pseudomonas syringae pv. syringae B728a

Annotation: Glycosyl transferase, family 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 831 transmembrane" amino acids 317 to 338 (22 residues), see Phobius details amino acids 344 to 363 (20 residues), see Phobius details amino acids 653 to 677 (25 residues), see Phobius details amino acids 686 to 708 (23 residues), see Phobius details amino acids 721 to 745 (25 residues), see Phobius details amino acids 772 to 791 (20 residues), see Phobius details amino acids 798 to 821 (24 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 393 to 621 (229 residues), 84.9 bits, see alignment E=1.4e-27 PF00535: Glycos_transf_2" amino acids 396 to 568 (173 residues), 84.1 bits, see alignment E=2.3e-27 PF13506: Glyco_transf_21" amino acids 408 to 709 (302 residues), 57.1 bits, see alignment E=2.9e-19 PF13632: Glyco_trans_2_3" amino acids 483 to 692 (210 residues), 87.5 bits, see alignment E=2.1e-28

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1332)

Predicted SEED Role

"probable glucosyl transferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZWT9 at UniProt or InterPro

Protein Sequence (831 amino acids)

>Psyr_1332 Glycosyl transferase, family 2 (Pseudomonas syringae pv. syringae B728a)
MDENSNNTGTWPTNLFKTRLNYPPNWPAMISGVAYAPFRPGQSPYKQIFPTRDQIREDLL
LLRSITRNIRTYSVEGTLMHIPELAEALGMNVTLGVWITEDETHNIEEINAGIELANRYS
SVQRLVLGNEVLFRDDVPIDLLIHYLQTARRAVNVPVSTSEIWTQWYETPDLVRHVDFIA
AHILPFWEGVSALDATAITLAHANELRTRFPDTPLILSEIGWPSKAIAKRRMTTSDAEHS
IYLRNQIPLLDQHGHDYFVIEAFDQHWKTEEGLPGPNWGLFDAKRRLKLHVNGPVKMPVN
MLSEILRLITRLKPESWPAGALIIVLAYCALSGFGMHYSQPLPAWLALPVVFIWAASVLT
YMGIETHEFLEACWGPDTPRSFSPVHRPVGPAPKVSLHVPCYNEPPDMVKRTLDSLQTLD
YPDFEVLVIDNNTQDPAIWKPIERYCQQLGPRFRFFHVSPLPGFKAGALNYLLRHTAEDA
EVVAVIDADYCVHRQWLKHMVPHFTDPKVAVIQSPQDYRDGHESLFKCCCQAEYRGFFNI
GMVIRNDHDAIIQHGTMTLIRRSALDRLGWAEWCICEDAELGLRMLESGFSTGYAAISYG
KGLTPDTFMDFKKQRYRWAYGAMQIVKRHAGSLIAGNCASLSAMQRYHFIAGWMPWVAEG
MNYLLTLAALAWSMAMILKPETFGPLPWIFSTSLILMFALRSFKMIVLYRRLVSTHIKEA
LAAILAGMALYPTLGKAVLAGLFTSAMPFYRTPKHTSANRIGQNLLDVREELSTLAISWI
AIVLLLTGRASIDTNSGFWITMLFAQSLPYLAAITMAILSARANRPALPTT