Protein Info for Psyr_1298 in Pseudomonas syringae pv. syringae B728a

Annotation: exonuclease RecJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 571 transmembrane" amino acids 184 to 200 (17 residues), see Phobius details TIGR00644: single-stranded-DNA-specific exonuclease RecJ" amino acids 20 to 566 (547 residues), 507.6 bits, see alignment E=1.7e-156 PF01368: DHH" amino acids 70 to 228 (159 residues), 93.9 bits, see alignment E=1.4e-30 PF02272: DHHA1" amino acids 355 to 448 (94 residues), 75.1 bits, see alignment E=8.4e-25 PF17768: RecJ_OB" amino acids 463 to 566 (104 residues), 82.6 bits, see alignment E=3.2e-27

Best Hits

Swiss-Prot: 58% identical to RECJ_SALTY: Single-stranded-DNA-specific exonuclease RecJ (recJ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K07462, single-stranded-DNA-specific exonuclease [EC: 3.1.-.-] (inferred from 100% identity to psb:Psyr_1298)

MetaCyc: 57% identical to ssDNA-specific exonuclease RecJ (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease VII. [EC: 3.1.11.6]

Predicted SEED Role

"Single-stranded-DNA-specific exonuclease RecJ (EC 3.1.-.-)" in subsystem DNA-replication or DNA Repair Base Excision or DNA repair, bacterial RecFOR pathway (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-, 3.1.11.6

Use Curated BLAST to search for 3.1.-.- or 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZWX3 at UniProt or InterPro

Protein Sequence (571 amino acids)

>Psyr_1298 exonuclease RecJ (Pseudomonas syringae pv. syringae B728a)
MRIEPRPLPDTLPFLGDLPPLLTRLYAARGVACEAELDKSLARLIPYQQLKGIDAAVDLL
VTALREGQRMLIVGDFDADGATASTVGVLGLRLLGAVHVDYLVPNRFEYGYGLTPEIVEV
ALQREPQLLITVDNGISSVEGVAAAKAAGLQVLVTDHHLPGHELPAADAIVNPNQPGCTF
PSKSLAGVGVIFYVLMALRARLRETGWFESNQRAQPNLGELLDLVALGSVADVVPLDANN
RILVHQGLMRIRAGRARPGLRAILEVARREPSRITSTDLGFILGPRLNAAGRLDDMSLGI
ECLLCDDPTLAREMAVQLDELNQDRKSIEQGMQREALAQLKDLPLESMPFGLCLFDAEWH
QGVIGILASRLKERYHRPTIAFASAGEGVLKGSARSVPGFHIRDALDAVAASHPHLISKF
GGHAMAAGLSLPEENFPAFAAAFDQEVRRQLDEQDLTGRLLSDGSLAVEEFHLELARALR
NAGPWGQHFPEPLFHGVFQLVEQRVVGERHLKMVLKTECGSVKLDGIAFGVDRDIWPNPN
IRWVELAYKLDLNEFRGNETVQLMVVHIAPR