Protein Info for Psyr_1290 in Pseudomonas syringae pv. syringae B728a

Annotation: homoserine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03447: NAD_binding_3
  • amino acids 39 to 156 (118 residues), 84.9 bits, E=1e-27
• PF00742: Homoserine_dh
  • amino acids 164 to 342 (179 residues), 221.7 bits, E=9.1e-70
• PF01842: ACT
  • amino acids 381 to 445 (65 residues), 53.2 bits, E=2.8e-18

Best Hits

Swiss-Prot: 90% identical to DHOM_PSEAE: Homoserine dehydrogenase (hom) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00003, homoserine dehydrogenase [EC: 1.1.1.3] (inferred from 100% identity to psb:Psyr_1290)

Predicted SEED Role

"Homoserine dehydrogenase (EC 1.1.1.3)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 1.1.1.3)

MetaCyc Pathways

• aspartate superpathway (22/25 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.3

Sequence Analysis Tools

See Q4ZWY1 at UniProt or InterPro

Protein Sequence (463 amino acids)

>Psyr_1290 homoserine dehydrogenase (Pseudomonas syringae pv. syringae B728a)
MSSKFQPHGAMRQFFHSRFRFGCFSGSSSVKPVKVGICGLGTVGGGTFNVLQRNAEEIAR
RAGRGIEVAQIAVRTPNPNCQITGTPTTSDVFAIATNPEIDIVVELIGGYTVARELVLKA
IENGKHVVTANKALIAVHGNEIFAKAREKGVIVAFEAAVAGGIPVIKAIREGLSANRINW
VAGIINGTGNFILTEMREKGRTFADVLAEAQALGYAEADPTFDVEGIDAAHKLTILASIA
FGIPLQFDKAYTEGITKLTTADVNYAEALGYRIKHLGVARSTAQGIELRVHPTLIPADRL
IANVNGVMNAVMVNGDASGSTLFYGAGAGMEPTASSVVADLVDVVRAMTSDPENRVPHLA
FQPDSLSAHPILPIEACESAYYLRIQAKDHPGVLAQVASILSERGINIESIMQKDVEEHD
GLVPMILLTHRVVEQRINDAIQALEALQDVVGPVVRIRVEHLN