Protein Info for Psyr_1280 in Pseudomonas syringae pv. syringae B728a

Annotation: Cytochrome c assembly protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 53 to 71 (19 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 110 to 129 (20 residues), see Phobius details amino acids 143 to 168 (26 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details amino acids 226 to 244 (19 residues), see Phobius details amino acids 256 to 274 (19 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 56 to 281 (226 residues), 137.4 bits, see alignment E=2.7e-44

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1280)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZWZ1 at UniProt or InterPro

Protein Sequence (284 amino acids)

>Psyr_1280 Cytochrome c assembly protein (Pseudomonas syringae pv. syringae B728a)
MPNSASFQARPSGSMSPLPPSLLPSLAAAIIYAAATVYQSLRLSQAVKPDKRLLCLLGAL
AVIAHAIGLFSQLTHSVGLGLDFFNSASLIAASVIVVTLIATSRIPVENLLVLLFPLGMV
TVLLAQFAPSGTVQPIMEEPGILSHILLSLLAYGMFTIAAFQALLLLLQDYRLKHKHPSG
LIKNFPPLQTMESLLFGFLWAGWSLLSLSLISGWLFVENLFAQHLVHKTLLACLAWIVFS
VLLWGRNRLGWRGHKAIRWTLGGFCLLMLAYFGSKLVREFILHI