Protein Info for Psyr_1252 in Pseudomonas syringae pv. syringae B728a

Annotation: Small GTP-binding protein protein domain:GTP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 TIGR03594: ribosome-associated GTPase EngA" amino acids 3 to 451 (449 residues), 567.9 bits, see alignment E=2.4e-174 TIGR00231: small GTP-binding protein domain" amino acids 4 to 156 (153 residues), 68.2 bits, see alignment E=1.1e-22 amino acids 195 to 357 (163 residues), 78.1 bits, see alignment E=9.6e-26 PF02421: FeoB_N" amino acids 5 to 129 (125 residues), 56.2 bits, see alignment E=1.2e-18 amino acids 196 to 358 (163 residues), 48.8 bits, see alignment E=2.3e-16 PF01926: MMR_HSR1" amino acids 5 to 119 (115 residues), 103 bits, see alignment E=4.1e-33 amino acids 197 to 315 (119 residues), 96.2 bits, see alignment E=5.5e-31 PF00009: GTP_EFTU" amino acids 196 to 365 (170 residues), 37.8 bits, see alignment E=6e-13 PF14714: KH_dom-like" amino acids 371 to 451 (81 residues), 93.9 bits, see alignment E=2.4e-30

Best Hits

Swiss-Prot: 100% identical to DER_PSEU2: GTPase Der (der) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K03977, GTP-binding protein (inferred from 100% identity to psb:Psyr_1252)

Predicted SEED Role

"GTP-binding protein EngA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZX19 at UniProt or InterPro

Protein Sequence (490 amino acids)

>Psyr_1252 Small GTP-binding protein protein domain:GTP-binding protein (Pseudomonas syringae pv. syringae B728a)
MVPVIALVGRPNVGKSTMFNRLTRTRDAIVGDLSGLTRDRQYGEAKWQGRSYILIDTGGI
SGDEHGMDEKMAEQSLLAIEEADVVLFLVDARAGYTAADQMIGEHLRKRNKRSYVVANKI
DNIDENLARAEFSPMGLGDAIPVAGAHGRGISQMLEIALREFPRDEDEPEEGVEVEEVAE
GQEAKRIPGPSEKDGIKIAIIGRPNVGKSTLVNRMLGEDRVIVYDEPGTTRDSIYIPFER
NEEKYTLIDTAGVRKRGKIHEEVEKFSVVKTLQAIKDANVVIFVMDAREGVVDHDLNLLG
FALEAGRALVIALNKWDGMTPGERDFVKIELERRLFFVDFADIHFISAMHGTGVGNLYQS
VQNSFKSAVTRWPTSRLTQILEDAVSEHAPPMVGSRRIKLRYAHLGGANPPLIVIHGNQV
EKVPKSYVRYLENTYRRVLKLVGTPIRIEFKGGENPYEGNKNTLTDRQVNKKRRMMSHHK
KADKKRRDKR