Protein Info for Psyr_1246 in Pseudomonas syringae pv. syringae B728a

Annotation: TPR repeat protein:TPR repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR02521: type IV pilus biogenesis/stability protein PilW" amino acids 8 to 240 (233 residues), 271.3 bits, see alignment E=3.5e-85 PF13181: TPR_8" amino acids 38 to 69 (32 residues), 17.6 bits, see alignment 1.8e-06 amino acids 145 to 173 (29 residues), 20.6 bits, see alignment (E = 2e-07) PF13424: TPR_12" amino acids 109 to 173 (65 residues), 33 bits, see alignment E=3e-11 PF07719: TPR_2" amino acids 146 to 172 (27 residues), 22.9 bits, see alignment (E = 3.6e-08) PF13432: TPR_16" amino acids 152 to 201 (50 residues), 19.8 bits, see alignment 5.1e-07

Best Hits

KEGG orthology group: K02656, type IV pilus assembly protein PilF (inferred from 100% identity to psb:Psyr_1246)

Predicted SEED Role

"Type IV pilus biogenesis protein PilF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZX25 at UniProt or InterPro

Protein Sequence (252 amino acids)

>Psyr_1246 TPR repeat protein:TPR repeat protein (Pseudomonas syringae pv. syringae B728a)
MPVRASLLLCVVVLLTACVSTGNVNPLTTAQGREEARKAYVQLGLGYFQQGQTERAKVPL
KKALELDSSDAQANAALALVFQTEMEPELAEQYFRKALAASNNETRIVNNYGSFLFEQKR
YKEAYERFEQAAADNLYPERSRVFESLGMTSLKLGNREQAREHFTKALRLDRQLPLSLLE
MAQLSYEDKQYVPARDYYDRFSQLSEQNARSLLLGTRLAKIYDDRNKAASFGLLLKRLYP
GTPEYQQYLSEQ