Protein Info for Psyr_1241 in Pseudomonas syringae pv. syringae B728a

Annotation: Fe-S protein assembly chaperone HscA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 620 TIGR01991: Fe-S protein assembly chaperone HscA" amino acids 21 to 617 (597 residues), 915.1 bits, see alignment E=9.4e-280 PF00012: HSP70" amino acids 21 to 600 (580 residues), 620.3 bits, see alignment E=3.2e-190 PF06723: MreB_Mbl" amino acids 127 to 377 (251 residues), 56.4 bits, see alignment E=2.3e-19

Best Hits

Swiss-Prot: 100% identical to HSCA_PSEU2: Chaperone protein HscA homolog (hscA) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K04044, molecular chaperone HscA (inferred from 100% identity to psb:Psyr_1241)

MetaCyc: 65% identical to iron-sulfur cluster biosynthesis chaperone HscA (Escherichia coli K-12 substr. MG1655)
3.6.4.-

Predicted SEED Role

"Chaperone protein HscA" in subsystem Protein chaperones

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZX30 at UniProt or InterPro

Protein Sequence (620 amino acids)

>Psyr_1241 Fe-S protein assembly chaperone HscA (Pseudomonas syringae pv. syringae B728a)
MALLQIAEPGLSPQPHQRRLAVGIDLGTTNSLVAAVRSGLSEPLADAEGQVILPSAVRYH
ADRVEVGQSAKIAASQDPFNTVLSVKRLMGRGLTDVKQLGEQLPYRFVGGESHMPFIDTV
QGPKSPVEVSADILKVLRQRAEASLGGELVGAVITVPAYFDDAQRQATKDAARLAGLNVL
RLLNEPTAAAVAYGLDQKAEGVVAIYDLGGGTFDISILRLTGGVFEVLATGGDTALGGDD
FDHAIASWIVTDAGLSADIDPSAQRSLLQAACSAKEALTDAESVEVVYGEWRGTLTREAL
NALIEPMVARSLKACRRAVRDTGIELEEVEAVVMVGGSTRVPRVREAVAELFGRQPLTEI
DPDQVVAIGAAIQADTLAGNKRDGGELLLLDVIPLSLGLETMGGLMEKVIPRNTTIPVAR
GQEFTTYKDGQTAMKIHVLQGERELISDCRSLARFELRGIPPMVAGAAKIRVTFQVDADG
LLSVSAREMGSGIESSIQVKPSYGLTDDEVTRMLKDSFEYAGDDKVARVLREHQVDAERL
LEAVQGALDADGERLLDEEERLVINLQMDELRELMQGTDGYAIEQQTKRLSQVTDAFAAR
RLDSTVKAALAGRNLNEIEE