Protein Info for Psyr_1240 in Pseudomonas syringae pv. syringae B728a

Annotation: Co-chaperone Hsc20

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 TIGR00714: Fe-S protein assembly co-chaperone HscB" amino acids 27 to 182 (156 residues), 107.8 bits, see alignment E=2.9e-35 PF00226: DnaJ" amino acids 30 to 84 (55 residues), 33.8 bits, see alignment E=2.9e-12 PF07743: HSCB_C" amino acids 101 to 175 (75 residues), 54.7 bits, see alignment E=1.1e-18

Best Hits

Swiss-Prot: 96% identical to HSCB_PSESM: Co-chaperone protein HscB homolog (hscB) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K04082, molecular chaperone HscB (inferred from 99% identity to psb:Psyr_1240)

Predicted SEED Role

"Chaperone protein HscB" in subsystem Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZX31 at UniProt or InterPro

Protein Sequence (184 amino acids)

>Psyr_1240 Co-chaperone Hsc20 (Pseudomonas syringae pv. syringae B728a)
MAKASTSEAFIVGTPCHFALFDLKPEFQLDLDQLATRYRELARNVHPDRFADAPEREQRV
ALERSASLNEAYQTLKSPPKRARYLLAMNGNEVPLEVTVHDPEFLLQQMQLREDLEDLQD
EADLAGVATFKRQLKIAQDELNQSFAACWNDAAQREHAEKLMRRMQFLDKLSDEVRQLEE
RLDD