Protein Info for Psyr_1208 in Pseudomonas syringae pv. syringae B728a

Annotation: type III secretion protein HrcR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 54 to 72 (19 residues), see Phobius details amino acids 141 to 156 (16 residues), see Phobius details amino acids 160 to 182 (23 residues), see Phobius details amino acids 192 to 214 (23 residues), see Phobius details TIGR01102: type III secretion apparatus protein, YscR/HrcR family" amino acids 11 to 212 (202 residues), 306 bits, see alignment E=6.5e-96 PF00813: FliP" amino acids 15 to 212 (198 residues), 210 bits, see alignment E=1.7e-66

Best Hits

Swiss-Prot: 99% identical to HRPW_PSESY: Harpin secretion protein HrpW (hrpW) from Pseudomonas syringae pv. syringae

KEGG orthology group: K03226, type III secretion protein SctR (inferred from 100% identity to psb:Psyr_1208)

Predicted SEED Role

"Type III secretion inner membrane protein (YscR,SpaR,HrcR,EscR,homologous to flagellar export components)" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZX60 at UniProt or InterPro

Protein Sequence (217 amino acids)

>Psyr_1208 type III secretion protein HrcR (Pseudomonas syringae pv. syringae B728a)
MIMEGINPIMLALFLGSLSLIPFLLIVCTAFLKIAMTLLITRNAIGVQQVPPNMALYGIA
LAATMFVMAPVAHDIQQRVHEHPLELSNADKLQSSLKVVIEPLQRFMTRNTDPDVVAHLL
ENTQRMWPKEMADQASKDDLLLAIPAFVLSELQAGFEIGFLIYIPFIVIDLIVSNLLLAL
GMQMVSPMTLSLPLKLLLFVLVSGWSRLLDSLFYSYM